PAIP1 Rabbit Polyclonal Antibody
CAT#: TA345966
Rabbit Polyclonal Anti-PAIP1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4537.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 9998.00
CNY 3080.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PAIP1 antibody: synthetic peptide directed towards the C terminal of human PAIP1. Synthetic peptide located within the following region: EPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPDYEENGTDLSGAGDPY |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 44 kDa |
Gene Name | poly(A) binding protein interacting protein 1 |
Database Link | |
Background | PAIP1 interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation.The protein encoded by this gene interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified. |
Synonyms | MGC12360 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |