RACK1 Rabbit Polyclonal Antibody
CAT#: TA345945
Rabbit Polyclonal Anti-GNB2L1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 2900.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GNB2L1 antibody: synthetic peptide directed towards the C terminal of human GNB2L1. Synthetic peptide located within the following region: LEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVW |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 35 kDa |
Gene Name | receptor for activated C kinase 1 |
Database Link | |
Background | GNB2L1 seems to bind protein kinase C acting as an intracellular receptor to anchor the activated PKC to the cytoskeleton. |
Synonyms | Gnb2-rs1; GNB2L1; H12.3; HLC-7; PIG21 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Horse: 93% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |