ZRSR2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZRSR2 antibody: synthetic peptide directed towards the N terminal of human ZRSR2. Synthetic peptide located within the following region: LKEQWEEQQRKEREEEEQKRQEKKEKEEALQKMLDQAENELENGTTWQNP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	58 kDa
Gene Name	zinc finger CCCH-type, RNA binding motif and serine/arginine rich 2
Database Link	NP_005080 Entrez Gene 8233 Human UniProt ID Q15696
Background	ZRSR2 is an essential splicing factor. The protein associates with the U2 auxiliary factor heterodimer, which is required for the recognition of a functional 3' splice site in pre-mRNA splicing, and may play a role in network interactions during spliceoso
Synonyms	U2AF1-RS2; U2AF1L2; U2AF1RS2; URP
Note	Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 85%; Yeast: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.