EMAP II (AIMP1) Rabbit Polyclonal Antibody

CAT#: TA345896

Rabbit Polyclonal Anti-SCYE1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Cited in 1 publication.

Product images

推荐一起购买 (2)
Transient overexpression lysate of aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 (AIMP1), transcript variant 1
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SCYE1 antibody: synthetic peptide directed towards the N terminal of human SCYE1. Synthetic peptide located within the following region: LLKEKAILQATLREEKKLRVENAKLKKEIEELKQELIQAEIQNGVKQIPF
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 34 kDa
Gene Name aminoacyl tRNA synthetase complex interacting multifunctional protein 1
Background SCYE1 is a cytokine that is specifically induced by apoptosis. The release of this cytokine renders the tumor-associated vasculature sensitive to tumor necrosis factor. The precursor of SCYE1 (pro-SCYE1) is identical to the p43 subunit, which is associated with the multi-tRNA synthetase complex. Therefore, pro-SCYE1 may function in binding RNA as part of the tRNA synthetase complex in normal cells and in stimulating inflammatory responses after proteolytic cleavage in tumor cells.The protein encoded by this gene is a cytokine that is specifically induced by apoptosis. The release of this cytokine renders the tumor-associated vasculature sensitive to tumor necrosis factor. The precursor of SCYE1 (pro-SCYE1) is identical to the p43 subunit, which is associated with the multi-tRNA synthetase complex. Therefore, pro-SCYE1 may function in binding RNA as part of the tRNA synthetase complex in normal cells and in stimulating inflammatory responses after proteolytic cleavage in tumor cells.
Synonyms EMAP2; EMAPII; HLD3; p43; SCYE1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 86%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Customer Reviews 
Loading...