EMAP II (AIMP1) Rabbit Polyclonal Antibody
CAT#: TA345896
Rabbit Polyclonal Anti-SCYE1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
Cited in 1 publication. |
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SCYE1 antibody: synthetic peptide directed towards the N terminal of human SCYE1. Synthetic peptide located within the following region: LLKEKAILQATLREEKKLRVENAKLKKEIEELKQELIQAEIQNGVKQIPF |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 34 kDa |
Gene Name | aminoacyl tRNA synthetase complex interacting multifunctional protein 1 |
Database Link | |
Background | SCYE1 is a cytokine that is specifically induced by apoptosis. The release of this cytokine renders the tumor-associated vasculature sensitive to tumor necrosis factor. The precursor of SCYE1 (pro-SCYE1) is identical to the p43 subunit, which is associated with the multi-tRNA synthetase complex. Therefore, pro-SCYE1 may function in binding RNA as part of the tRNA synthetase complex in normal cells and in stimulating inflammatory responses after proteolytic cleavage in tumor cells.The protein encoded by this gene is a cytokine that is specifically induced by apoptosis. The release of this cytokine renders the tumor-associated vasculature sensitive to tumor necrosis factor. The precursor of SCYE1 (pro-SCYE1) is identical to the p43 subunit, which is associated with the multi-tRNA synthetase complex. Therefore, pro-SCYE1 may function in binding RNA as part of the tRNA synthetase complex in normal cells and in stimulating inflammatory responses after proteolytic cleavage in tumor cells. |
Synonyms | EMAP2; EMAPII; HLD3; p43; SCYE1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Porcine cytokines, chemokines and growth factors: 2019 update
,Dawson, HD;Sang, Y;Lunney, JK;,
Res. Vet. Sci.
,PubMed ID 32442727
[AIMP1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它EMAP II产品