TRA2B Rabbit Polyclonal Antibody
CAT#: TA345883
Rabbit Polyclonal Anti-SFRS10 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SFRS10 antibody: synthetic peptide directed towards the middle region of human SFRS10. Synthetic peptide located within the following region: GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 32 kDa |
Gene Name | transformer 2 beta homolog (Drosophila) |
Database Link | |
Background | SFRS10 contains 1 RRM (RNA recognition motif) domain and belongs to the splicing factor SR family. It is a sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing. |
Synonyms | Htra2-beta; PPP1R156; SFRS10; SRFS10; TRA2-BETA; TRAN2B |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Spliceosome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |