KHSRP Rabbit Polyclonal Antibody
CAT#: TA345845
Rabbit Polyclonal Anti-KHSRP Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
Cited in 1 publication. |
CNY 4,840.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-KHSRP antibody is: synthetic peptide directed towards the middle region of Human KHSRP. Synthetic peptide located within the following region: IIGDPYKVQQACEMVMDILRERDQGGFGDRNEYGSRIGGGIDVPVPRHSV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 78 kDa |
Gene Name | KH-type splicing regulatory protein |
Database Link | |
Background | The KHSRP gene encodes a multifunctional RNA-binding protein implicated in a variety of cellular processes, including transcription, alternative pre-mRNA splicing, and mRNA localization. |
Synonyms | FBP2; FUBP2; KSRP |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Nerve growth factor from Chinese cobra venom stimulates chondrogenic differentiation of mesenchymal stem cells
,null,
Cell Death & Disease
,PubMed ID 28518137
[KHSRP]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |