SNRPB Rabbit Polyclonal Antibody

CAT#: TA345827

Rabbit Polyclonal Anti-SNRPB Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 1
    • 100 ug

CNY 3080.00


Transient overexpression lysate of small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 2
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SNRPB antibody: synthetic peptide directed towards the N terminal of human SNRPB. Synthetic peptide located within the following region: DKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 24 kDa
Gene Name small nuclear ribonucleoprotein polypeptides B and B1
Background SNRPB is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing or
Synonyms B; CCMS; COD; Sm-B; SmB; snRNP-B; SNRPB1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Families Stem cell - Pluripotency
Protein Pathways Spliceosome, Systemic lupus erythematosus
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...