SNRPB Rabbit Polyclonal Antibody
CAT#: TA345827
Rabbit Polyclonal Anti-SNRPB Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SNRPB antibody: synthetic peptide directed towards the N terminal of human SNRPB. Synthetic peptide located within the following region: DKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 24 kDa |
Gene Name | small nuclear ribonucleoprotein polypeptides B and B1 |
Database Link | |
Background | SNRPB is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing or |
Synonyms | B; CCMS; COD; Sm-B; SmB; snRNP-B; SNRPB1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93% |
Reference Data | |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Spliceosome, Systemic lupus erythematosus |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |