NOVA2 Rabbit Polyclonal Antibody
CAT#: TA345800
Rabbit Polyclonal Anti-NOVA2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,537.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-NOVA2 antibody: synthetic peptide directed towards the N terminal of human NOVA2. Synthetic peptide located within the following region: MEPEAPDSRKRPLETPPEVVCTKRSNTGEEGEYFLKVLIPSYAAGSIIGK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 54 kDa |
Gene Name | NOVA alternative splicing regulator 2 |
Database Link | |
Background | NOVA2 may regulate RNA splicing or metabolism in a specific subset of developing neurons. It binds single strand RNA. |
Synonyms | ANOVA; NOVA3 |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Dog: 77%; Rat: 77%; Bovine: 77%; Guinea pig: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |