Placental lactogen (CSH1) Rabbit Polyclonal Antibody
CNY 4537.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 9998.00
CNY 3080.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CSH1 antibody: synthetic peptide directed towards the middle region of human CSH1. Synthetic peptide located within the following region: SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 24 kDa |
Gene Name | chorionic somatomammotropin hormone 1 |
Database Link | |
Background | CSH1 is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome.The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome. |
Synonyms | CS-1; CSA; CSMT; hCS-1; hCS-A; PL |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Jak-STAT signaling pathway, Neuroactive ligand-receptor interaction |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它Placental lactogen产品