Foxc2 Rabbit Polyclonal Antibody
CAT#: TA345653
Rabbit Polyclonal Anti-Foxc2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Foxc2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GMGRSYAPYHHQPAAPKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQF |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 53 kDa |
Gene Name | forkhead box C2 |
Database Link | |
Background | Foxc2 is a transcriptional activator. Foxc2 might be involved in the formation of special mesenchymal tissues. |
Synonyms | FKHL14; LD; MFH-1; MFH1 |
Note | Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Bovine: 93%; Guinea pig: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |