Taf1c Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Taf1c antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RRHRGETSETQTQSKRPKRRTQLSSTFSSFTSYLDSPDASSAPRSQDLST
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	92 kDa
Gene Name	TATA-box binding protein associated factor, RNA polymerase I, C
Database Link	NP_067416 Entrez Gene 21341 Mouse UniProt ID Q6PDZ2
Background	Taf1c is a component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC (preinitiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation probably is primarily dependent on the rate of association of SL1/TIF-IB with the rDNA promoter. SL1/TIF-IB is involved in stabilization of nucleolar transcription factor 1/UBTF on rDNA. Formation of SL1/TIF-IB excludes the association of TBP with TFIID subunits. Taf1c recruits RNA polymerase I to the rRNA gene promoter via interaction with RRN3.
Synonyms	MGC:39976; SL1; TAFI95; TAFI110
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Pig: 85%; Guinea pig: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.