Ppargc1a Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Ppargc1a antibody: synthetic peptide directed towards the middle region of mouse Ppargc1a. Synthetic peptide located within the following region: QEIRAELNKHFGHPCQAVFDDKSDKTSELRDGDFSNEQFSKLPVFINSGL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	90 kDa
Gene Name	peroxisome proliferative activated receptor, gamma, coactivator 1 alpha
Database Link	NP_032930 Entrez Gene 19017 Mouse UniProt ID O70343
Background	Ppargc1a is a transcriptional coactivator for steroid receptors and nuclear receptors. Ppargc1a greatly increases the transcriptional activity of PPARG and thyroid hormone receptor on the uncoupling protein promoter. Ppargc1a can regulate key mitochondrial genes that contribute to the program of adaptive thermogenesis.
Synonyms	LEM6; PGC-1(alpha); PGC-1-alpha; PGC-1v; PGC1; PGC1A; PPARGC-1-alpha; PPARGC1
Note	Immunogen Sequence Homology: Mouse: 100%; Pig: 92%; Rat: 92%; Horse: 92%; Rabbit: 92%; Guinea pig: 92%; Goat: 86%; Bovine: 86%; Dog: 83%; Human: 83%; Sheep: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.