TFAP2E Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TFAP2E antibody: synthetic peptide directed towards the C terminal of human TFAP2E. Synthetic peptide located within the following region: FGGPAICAALTAFQNYLLESLKGLDKMFLSSVGSGHGETKASEKDAKHRK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	transcription factor AP-2 epsilon
Database Link	NP_848643 Entrez Gene 339488 Human UniProt ID Q6VUC0
Background	TFAP2E belongs to AP-2 family of transcription factors which play an important role in regulating gene expression during development and differentiation of multiple organs and tissues. It may play an important role in skin biology.
Synonyms	AP2E
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Mouse: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.