NFAT2 (NFATC1) Rabbit Polyclonal Antibody

CAT#: TA345589

Rabbit Polyclonal Anti-NFATC1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5200.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1 (NFATC1), transcript variant 1, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1 (NFATC1), transcript variant 4
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-NFATC1 antibody: synthetic peptide directed towards the C terminal of human NFATC1. Synthetic peptide located within the following region: LLPEVHEDGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 100 kDa
Gene Name nuclear factor of activated T-cells 1
Background NFATC1 is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Different isoforms of this protein may regulate inducible expression of different cytokine genes.
Synonyms NF-ATC; NF-ATc1.2; NFAT2; NFATc
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 91%; Horse: 91%; Guinea pig: 91%; Zebrafish: 86%; Bovine: 79%
Reference Data
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Axon guidance, B cell receptor signaling pathway, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway, VEGF signaling pathway, Wnt signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...