ZNF555 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF555 antibody: synthetic peptide directed towards the N terminal of human ZNF555. Synthetic peptide located within the following region: DSVVFEDVAVDFTLEEWALLDSAQRDLYRDVMLETFQNLASVDDETQFKA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	73 kDa
Gene Name	zinc finger protein 555
Database Link	NP_690004 Entrez Gene 148254 Human UniProt ID Q8NEP9
Background	ZNF555 contains 15 C2H2-type zinc fingers and 1 KRAB domain. It belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Synonyms	FLJ41894; MGC26707
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 86%; Horse: 86%; Bovine: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.