CBLL2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF645 antibody: synthetic peptide directed towards the middle region of human ZNF645. Synthetic peptide located within the following region: LSPQFTQTDAMDHRRWPAWKRLSPCPPTRSPPPSTLHGRSHHSHQRRHRR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	zinc finger protein 645
Database Link	NP_689790 Entrez Gene 158506 Human UniProt ID Q8N7E2
Background	ZNF645 contains 1 RING-type zinc finger, which is probably involved in mediating protein-protein interactions.
Synonyms	CT138; HAKAIL
Note	Immunogen Sequence Homology: Human: 100%; Yeast: 85%; Dog: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.