ZNF641 Rabbit Polyclonal Antibody
CAT#: TA345535
Rabbit Polyclonal Anti-ZNF641 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-ZNF641 antibody: synthetic peptide directed towards the middle region of human ZNF641. Synthetic peptide located within the following region: RHWLTHTGEKPFQCPRCEKSFGRKHHLDRHLLTHQGQSPRNSWDRGTSVF |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 49 kDa |
| Gene Name | zinc finger protein 641 |
| Database Link | |
| Background | ZNF641 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 5 C2H2-type zinc fingers and 1 KRAB domain. ZNF641 activates transcriptional activities of SRE and AP-1. |
| Synonyms | DKFZp667D1012; FLJ31295 |
| Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Mouse: 86%; Rabbit: 86%; Guinea pig: 79% |
| Reference Data | |
| Protein Families | Transcription Factors |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
