Dmbx1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Dmbx1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Dmbx1. Synthetic peptide located within the following region: SLSAAAAAHQGVWGSPLLPAPPTGLAPASAALNSKTTSIENLRLRAKQHA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	diencephalon/mesencephalon homeobox 1
Database Link	NP_570935 Entrez Gene 140477 Mouse UniProt ID Q91ZK4
Background	Dmbx1 functions as a transcriptional repressor. It may repress OTX2-mediated transactivation by forming a heterodimer with OTX2 on the P3C (5'-TAATCCGATTA-3') sequence and is required for brain development, neonatal survival, postnatal growth, and nursing ability.
Synonyms	MBX; OTX3; PAXB
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.