HSFY1 Rabbit Polyclonal Antibody
CAT#: TA345471
Rabbit Polyclonal Anti-HSFY1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-HSFY1 antibody: synthetic peptide directed towards the N terminal of human HSFY1. Synthetic peptide located within the following region: MAHVSSETQDVSPKDELTASEASTRSPLCEHTFPGDSDLRSMIEEHAFQV |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 45 kDa |
| Gene Name | heat shock transcription factor, Y-linked 1 |
| Database Link | |
| Background | HSFY1 is a member of the heat shock factor (HSF) family of transcriptional activators for heat shock proteins. This gene is a candidate gene for azoospermia, since it localizes to a region of chromosome Y that is sometimes deleted in infertile males. The |
| Synonyms | HSF2L; HSFY |
| Note | Immunogen Sequence Homology: Human: 100%; Dog: 92%; Horse: 77% |
| Reference Data | |
| Protein Families | Transcription Factors |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
