TRIM56 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TRIM56 antibody: synthetic peptide directed towards the middle region of human TRIM56. Synthetic peptide located within the following region: DPKGSLLGDFLTAYHGLEKPRVTTMVDGRYLVVSLSNGTIHIFRVRSPDS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	81 kDa
Gene Name	tripartite motif containing 56
Database Link	NP_112223 Entrez Gene 81844 Human UniProt ID Q9BRZ2
Background	TRIM56 belongs to the TRIM/RBCC family. It contains 2 B box-type zinc fingers and 1 RING-type zinc finger. The function of the TRIM56 protein remains unknown.
Synonyms	RNF109
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Bovine: 100%; Mouse: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.