PHF17 (JADE1) Rabbit Polyclonal Antibody
CAT#: TA345410
Rabbit Polyclonal Anti-PHF17 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PHF17 antibody: synthetic peptide directed towards the middle region of human PHF17. Synthetic peptide located within the following region: VNLLDVARALRLPEEVVDFLYQYWKLKRKVNFNKPLITPKKDEEDNLAKR |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 95 kDa |
Gene Name | jade family PHD finger 1 |
Database Link | |
Background | PHF17 belongs to the JADE family. It contains 2 PHD-type zinc fingers. PHF17 is a transcriptional coactivator which seems to act by promoting acetylation of nucleosomal histone H4 by HTATIP. PHF17 promotes apoptosis. Itmay act as a renal tumor suppressor. |
Synonyms | PHF17 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |