HSPBAP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HSPBAP1 antibody: synthetic peptide directed towards the N terminal of human HSPBAP1. Synthetic peptide located within the following region: AAGSEATTPVIVAAGAGGEEGEHVKPFKPEKAKEIIMSLQQPAIFCNMVF
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	HSPB1 associated protein 1
Database Link	NP_078886 Entrez Gene 79663 Human UniProt ID Q96EW2
Background	HSPBAP1 may play a role in cellular stress response. A chromosomal aberration involving HSPBAP1 is found in familial renal cell carcinoma 1 (RCC1).
Synonyms	PASS1
Note	Immunogen Sequence Homology: Human: 100%; Horse: 92%; Rat: 86%; Mouse: 86%; Bovine: 86%; Dog: 85%; Pig: 83%; Guinea pig: 83%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.