KDM6A Rabbit Polyclonal Antibody

CAT#: TA345322

Rabbit Polyclonal Anti-UTX Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of lysine (K)-specific demethylase 6A (KDM6A)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human ubiquitously transcribed tetratricopeptide repeat, X chromosome (UTX), 20 µg
    • 20 ug

CNY 2900.00


Recombinant protein of human ubiquitously transcribed tetratricopeptide repeat, X chromosome (UTX), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-UTX antibody: synthetic peptide directed towards the N terminal of human UTX. Synthetic peptide located within the following region: MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALG
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 154 kDa
Gene Name lysine demethylase 6A
Background UTX is a histone demethylase that specifically demethylates 'Lys-27' of histone H3, thereby playing a central role in histone code. It demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-27'. UTX plays a central role in regulation of posterior development, by regulating HOX gene expression. Demethylation of 'Lys-27' of histone H3 is concomitent with methylation of 'Lys-4' of histone H3, and regulates the recruitment of the PRC1 complex and monoubiquitination of histone H2A.
Synonyms bA386N14.2; KABUK2; UTX
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%; Bovine: 93%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...