ZNF529 Rabbit Polyclonal Antibody
CAT#: TA345310
Rabbit Polyclonal Anti-ZNF529 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF529 antibody: synthetic peptide directed towards the N terminal of human ZNF529. Synthetic peptide located within the following region: EVMESSKLCGLEGSIFRNDWQSKSKIDLQGPEVGYFSQMKIISENVPSYK |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 54 kDa |
Gene Name | zinc finger protein 529 |
Database Link | |
Background | The function of the Anti-ZNF529 gene has not yet been determined |
Synonyms | KIAA1615 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 86%; Dog: 85%; Horse: 83%; Bovine: 83% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |