ZFP28 Rabbit Polyclonal Antibody
CAT#: TA345299
Rabbit Polyclonal Anti-ZFP28 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 4840.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-ZFP28 antibody: synthetic peptide directed towards the middle region of human ZFP28. Synthetic peptide located within the following region: RKTFIQIGHLNQHKRVHTGERSYNYKKSRKVFRQTAHLAHHQRIHTGESS |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 99 kDa |
| Gene Name | ZFP28 zinc finger protein |
| Database Link | |
| Background | ZFP28 may be involved in transcriptional regulation. ZFP28 may also have a role in embryonic development. |
| Synonyms | mkr5 |
| Note | Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Guinea pig: 92% |
| Reference Data | |
| Protein Families | Transcription Factors |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
