ZNF691 Rabbit Polyclonal Antibody
CAT#: TA345183
Rabbit Polyclonal Anti-ZNF691 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF691 antibody: synthetic peptide directed towards the N terminal of human ZNF691. Synthetic peptide located within the following region: MGSEKEQSPEPHLPEEGEGGKPWRVDDSEGSWIPPGEKEHGQESLSDELQ |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 32 kDa |
Gene Name | zinc finger protein 691 |
Database Link | |
Background | ZNF691 may be involved in transcriptional regulation. |
Synonyms | Zfp691 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Rabbit: 93%; Rat: 92%; Pig: 90%; Guinea pig: 90%; Bovine: 86%; Mouse: 85% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |