ZNF793 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF793 antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF793. Synthetic peptide located within the following region: KDVVVGFTQEEWHRLSPAQRALYRDVMLETYSNLASVGYEGTKPDVILRL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	zinc finger protein 793
Database Link	NP_001013681 Entrez Gene 390927 Human UniProt ID Q6ZN11
Background	ZNF793 may be involved in transcriptional regulation.
Synonyms	ZNF793
Note	Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 92%; Horse: 92%; Bovine: 92%; Rabbit: 85%; Rat: 83%; Mouse: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.