Brk (PTK6) Rabbit Polyclonal Antibody

CAT#: TA345165

Rabbit Polyclonal Anti-PTK6 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of PTK6 protein tyrosine kinase 6 (PTK6)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human PTK6 protein tyrosine kinase 6 (PTK6), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human PTK6 protein tyrosine kinase 6 (PTK6), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PTK6 antibody: synthetic peptide directed towards the middle region of human PTK6. Synthetic peptide located within the following region: SELLDIAWQVAEGMCYLESQNYIHRDLAARNILVGENTLCKVGDFGLARL
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 52 kDa
Gene Name protein tyrosine kinase 6
Background The protein encoded by this gene is a cytoplasmic nonreceptor protein kinase which may function as an intracellular signal transducer in epithelial tissues. Overexpression of this gene in mammary epithelial cells leads to sensitization of the cells to epidermal growth factor and results in a partially transformed phenotype. Expression of this gene has been detected at low levels in some breast tumors but not in normal breast tissue. The encoded protein has been shown to undergo autophosphorylation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2012]
Synonyms BRK
Note Immunogen Sequence Homology: Human: 100%; Horse: 85%
Reference Data
Protein Families Druggable Genome, Protein Kinase, Secreted Protein
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...