LAP3 Rabbit Polyclonal Antibody
CAT#: TA345101
Rabbit Polyclonal Anti-LAP3 Antibody - N-terminal region
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Lap3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QDLELPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKVAVSAKLHGSGD |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 57 kDa |
Gene Name | leucine aminopeptidase 3 |
Database Link | |
Background | Lap3 is presumably involved in the processing and regular turnover of intracellular proteins. It catalyzes the removal of unsubstituted N-terminal amino acids from various peptides. |
Synonyms | HEL-S-106; LAP; LAPEP; PEPS |
Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 86%; Zebrafish: 79% |
Reference Data | |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Arginine and proline metabolism, Glutathione metabolism, Metabolic pathways |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |