UCH37 (UCHL5) Rabbit Polyclonal Antibody
CAT#: TA345084
Rabbit Polyclonal Anti-UCHL5 Antibody - middle region
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human, Zebrafish |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-UCHL5 antibody: synthetic peptide directed towards the middle region of human UCHL5. Synthetic peptide located within the following region: DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 37 kDa |
Gene Name | ubiquitin C-terminal hydrolase L5 |
Database Link | |
Background | UCHL5 is the deubiquitinating enzyme associated with the proteasome. |
Synonyms | CGI-70; INO80R; UCH-L5; UCH37 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome, Protease |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |