VPS28 Rabbit Polyclonal Antibody

CAT#: TA345056

Rabbit Polyclonal Anti-VPS28 Antibody - N-terminal region



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 2
    • 100 ug

CNY 3080.00


Recombinant protein of human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1, 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human, Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-VPS28 antibody: synthetic peptide directed towards the N terminal of human VPS28. Synthetic peptide located within the following region: MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQ
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 25 kDa
Gene Name VPS28, ESCRT-I subunit
Background This gene encodes a protein subunit of the ESCRT-I complex (endosomal complexes required for transport), which functions in the transport and sorting of proteins into subcellular vesicles. This complex can also be hijacked to facilitate the budding of enveloped viruses from the cell membrane. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]
Synonyms MGC60323
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Pathways Endocytosis
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...