Glutaredoxin 5 (GLRX5) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GLRX5 antibody: synthetic peptide directed towards the middle region of human GLRX5. Synthetic peptide located within the following region: NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	16 kDa
Gene Name	glutaredoxin 5
Database Link	NP_057501 Entrez Gene 51218 Human UniProt ID Q86SX6
Background	Defects in GLRX5 are the cause of anemia sideroblastic pyridoxine-refractory autosomal recessive (PRARSA). The specific function of GLRX5 is not yet known.
Synonyms	C14orf87; FLB4739; GRX5; PR01238; PRO1238; PRSA; SIDBA3; SPAHGC
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.