XAF1 Rabbit Polyclonal Antibody
CAT#: TA344995
Rabbit Polyclonal Anti-XAF1 Antibody - middle region
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
Cited in 1 publication. |
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-XAF1 antibody: synthetic peptide directed towards the middle region of human XAF1. Synthetic peptide located within the following region: RSINRFPLHSESSSKKAPRSKNKTLDPLLMSEPKPRTSSPRGDKAAYDIL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 34 kDa |
Gene Name | XIAP associated factor 1 |
Database Link | |
Background | X-linked inhibitor of apoptosis (XIAP; MIM 300079) is a potent member of the IAP family. All members of this family possess baculoviral IAP (BIR) repeats, cysteine-rich domains of approximately 80 amino acids that bind and inhibit caspases (e.g., CASP3; M |
Synonyms | BIRC4BP; HSXIAPAF1; XIAPAF1 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
XAF1 is frequently methylated in human esophageal cancer
,null,
World Journal of Gastroenterology : WJG
,PubMed ID 22719195
[XAF1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |