ENAH Rabbit Polyclonal Antibody
CAT#: TA344908
Rabbit Polyclonal Anti-ENAH Antibody - C-terminal region
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Enah antibody is: synthetic peptide directed towards the C-terminal region of Mouse Enah. Synthetic peptide located within the following region: RRIAEKGSTIETEQKEDRNEDAEPITAKAPSTSTPEPTRKPWERTNTMNG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 84 kDa |
Gene Name | enabled homolog (Drosophila) |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | ENA; MENA; NDPP1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rat: 93%; Mouse: 92%; Bovine: 86%; Guinea pig: 86% |
Reference Data | |
Protein Pathways | Regulation of actin cytoskeleton |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |