VPS53 Rabbit Polyclonal Antibody
CAT#: TA344886
Rabbit Polyclonal Anti-VPS53 Antibody - middle region
Need it in bulk or conjugated? 
                            Get a free quote
                        
CNY 4628.00
CNY 4840.00
                                                
                                                
                                                
                                                    CNY 300.00 
                                                    
                                                    CNY 1430.00
                                                
                                            
                                                
                                                
                                                
                                                    CNY 2900.00 
                                                    
                                                    CNY 6650.00
                                                
                                            
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB | 
| Recommend Dilution | WB | 
| Reactivity | Human | 
| Host | Rabbit | 
| Clonality | Polyclonal | 
| Immunogen | The immunogen for anti-VPS53 antibody: synthetic peptide directed towards the middle region of human VPS53. Synthetic peptide located within the following region: VYIESQDKNLGELIDRFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYKK | 
| Isotype | IgG | 
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.  | 
        
| Purification | Affinity Purified | 
| Conjugation | Unconjugated | 
| Storage Condition | Store at -20°C as received. | 
| Predicted Protein Size | 92 kDa | 
| Gene Name | VPS53, GARP complex subunit | 
| Database Link | |
| Background | This gene encodes a protein with sequence similarity to the yeast Vps53p protein. Vps53p is involved in retrograde vesicle trafficking in late Golgi. | 
| Synonyms | HCCS1; hVps53L; PCH2E; pp13624 | 
| Note | Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Zebrafish: 79% | 
| Reference Data | |
Documents
| Product Manuals | 
| FAQs | 
| SDS | 
Resources
| 抗体相关资料 | 
