BXDC2 (BRIX1) Rabbit Polyclonal Antibody
CAT#: TA344879
Rabbit Polyclonal Anti-BXDC2 Antibody - middle region
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-BXDC2 antibody: synthetic peptide directed towards the middle region of human BXDC2. Synthetic peptide located within the following region: IWFRNFQIIEEDAALVEIGPRFVLNLIKIFQGSFGGPTLYENPHYQSPNM |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 41 kDa |
Gene Name | BRX1, biogenesis of ribosomes |
Database Link | |
Background | BXDC2 is required for biogenesis of the 60S ribosomal subunit. |
Synonyms | BRIX; BXDC2 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 93%; Goat: 86% |
Reference Data | |
Protein Families | Embryonic stem cells, Stem cell - Pluripotency |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |