TCP11L1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TCP11L1 antibody is: synthetic peptide directed towards the C-terminal region of Human TCP11L1. Synthetic peptide located within the following region: GQIQAVASPDDPIRRIMESRILTFLETYLASGHQKPLPTVPGGLSPVQRE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	65 kDa
Gene Name	t-complex 11 like 1
Database Link	NP_060863 Entrez Gene 55346 Human UniProt ID Q9NUJ3
Background	The function of this protein remains unknown.
Synonyms	dJ85M6.3
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Guinea pig: 93%; Rabbit: 92%; Dog: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.