FAM45B (FAM45BP) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FAM45B antibody: synthetic peptide directed towards the middle region of human FAM45B. Synthetic peptide located within the following region: FLSKDFDARKAYPAGSIKDIVSQFGMETVILHTALMLKKRIVVYHPKIEA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	family with sequence similarity 45 member B, pseudogene
Database Link	NP_060942 Entrez Gene 55855 Human
Background	The function of this protein remains unknown.
Synonyms	HT011
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Mouse: 92%; Guinea pig: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.