LRDD (PIDD1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LRDD antibody: synthetic peptide directed towards the N terminal of human LRDD. Synthetic peptide located within the following region: RLQGNPLGEASPDAPSSPVAALIPEMPRLFLTSDLDSFPVTPQGCSVTLA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	83 kDa
Gene Name	p53-induced death domain protein 1
Database Link	NP_060964 Entrez Gene 55367 Human UniProt ID Q9HB75
Background	The protein encoded by this gene contains a leucine-rich repeat and a death domain. This protein has been shown to interact with other death domain proteins, such as Fas (TNFRSF6)-associated via death domain (FADD) and MAP-kinase activating death domain-c
Synonyms	DKFZp434D229; leucine-rich and death domain containing; leucine-rich repeats and death domain containing; leucine rich repeat and death domain containing protein; MGC16925; PIDD
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 86%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	p53 signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.