CPA6 Rabbit Polyclonal Antibody
CAT#: TA344790
Rabbit Polyclonal Anti-CPA6 Antibody - middle region
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CPA6 antibody: synthetic peptide directed towards the middle region of human CPA6. Synthetic peptide located within the following region: QSVYGVRYRYGPASTTLYVSSGSSMDWAYKNGIPYAFAFELRDTGYFGFL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 51 kDa |
Gene Name | carboxypeptidase A6 |
Database Link | |
Background | The protein encoded by this gene belongs to the family of carboxypeptidases, which catalyze the release of C-terminal amino acid, and have functions ranging from digestion of food to selective biosynthesis of neuroendocrine peptides. Polymorphic variants and a reciprocal translocation t(6;8)(q26;q13) involving this gene, have been associated with Duane retraction syndrome. |
Synonyms | CPAH; ETL5; FEB11 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93% |
Reference Data | |
Protein Families | Protease, Secreted Protein |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |