ACTR3B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ACTR3B antibody: synthetic peptide directed towards the N terminal of human ACTR3B. Synthetic peptide located within the following region: DHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	ARP3 actin-related protein 3 homolog B (yeast)
Database Link	NP_065178 Entrez Gene 57180 Human UniProt ID Q9P1U1
Background	ACTR3B plays a role in the organization of the actin cytoskeleton.ACTR3B may function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ACTR3B may decrease the metastatic potential of tumors.
Synonyms	ARP3BETA; ARP11
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.