RIMKLB Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Rimklb antibody is: synthetic peptide directed towards the N-terminal region of Mouse Rimklb. Synthetic peptide located within the following region: FRAVVMDEMVLTVEQGNLGLRISGELISAYPQVVVVRVPTPWVQSDSDIT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	ribosomal modification protein rimK-like family member B
Database Link	NP_065785 Entrez Gene 108653 Mouse UniProt ID Q9ULI2
Background	Rimklb catalyzes the synthesis of beta-citryl-glutamate and N-acetyl-aspartyl-glutamate. Beta-citryl-glutamate is synthesized more efficiently than N-acetyl-aspartyl-glutamate.
Synonyms	FAM80B; NAAGS; NAAGS-I
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Rat: 93%; Bovine: 93%; Guinea pig: 93%; Mouse: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.