Vipas39 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-LOC681989 antibody is: synthetic peptide directed towards the middle region of Rat LOC681989. Synthetic peptide located within the following region: PPSTYSLSSFFRGRTRPGSFQSLSDALSDTPAKTYSPELGRPKGEYRDYS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	VPS33B interacting protein, apical-basolateral polarity regulator, spe-39 homolog
Database Link	NP_001094474 Entrez Gene 681989 Rat UniProt ID Q5PQN6
Background	LOC681989 plays a role in lysosomal trafficking, probably via association with the core HOPS complex in a discrete population of endosomes. It may play a role in epithelial polarization through stabilization of apical membrane protein content, possibly via the RAB11A-dependent apical recycling pathway. It is also involved in direct or indirect transcriptional regulation of E-cadherin and may play a role in vesicular trafficking during spermatogenesis.
Synonyms	C14orf133; hSPE-39; SPE-39; SPE39; VIPAR; VPS16B
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.