Spastin (SPAST) Rabbit Polyclonal Antibody
CAT#: TA344697
Rabbit Polyclonal Anti-SPAST Antibody - middle region
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SPAST antibody is: synthetic peptide directed towards the middle region of Human SPAST. Synthetic peptide located within the following region: RVLVMGATNRPQELDEAVLRRFIKRVYVSLPNEETRLLLLKNLLCKQGSP |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 54 kDa |
Gene Name | spastin |
Database Link | |
Background | This gene encodes a member of the AAA (ATPases associated with a variety of cellular activities) protein family. Members of this protein family share an ATPase domain and have roles in diverse cellular processes including membrane trafficking, intracellular motility, organelle biogenesis, protein folding, and proteolysis. The encoded ATPase may be involved in the assembly or function of nuclear protein complexes. Two transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants have been described but their full length sequences have not been determined. Mutations associated with this gene cause the most frequent form of autosomal dominant spastic paraplegia 4. |
Synonyms | ADPSP; FSP2; SPG4 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 93% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它Spastin产品