PKIB Rabbit Polyclonal Antibody
CAT#: TA344652
Rabbit Polyclonal Anti-PKIB Antibody - middle region
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 9998.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Rat |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Pkib antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TDVESVISSFASSARAGRRNALPDIQSSLATGGSPDLALKLEALAVKEDA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 12 kDa |
Gene Name | protein kinase (cAMP-dependent, catalytic) inhibitor beta |
Database Link | |
Background | Pkib displays strong inhibition of the activity of cAMP-dependent protein kinase. |
Synonyms | PRKACN2 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Pig: 92%; Guinea pig: 92%; Dog: 90%; Horse: 90%; Bovine: 90%; Goat: 85% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |