CARD9 Rabbit Polyclonal Antibody
CAT#: TA344643
Rabbit Polyclonal Anti-CARD9 Antibody - middle region
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
Cited in 1 publication. |
CNY 4840.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CARD9 antibody: synthetic peptide directed towards the middle region of human CARD9. Synthetic peptide located within the following region: ALHQEQVLRNPHDAGLSSGEPPEKERRRLKESFENYRRKRALRKMQKGWR |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 62 kDa |
Gene Name | caspase recruitment domain family member 9 |
Database Link | |
Background | The protein encoded by this gene is a member of the CARD protein family, which is defined by the presence of a characteristic caspase-associated recruitment domain (CARD). CARD is a protein interaction domain known to participate in activation or suppression of CARD containing members of the caspase family, and thus plays an important regulatory role in cell apoptosis. This protein was identified by its selective association with the CARD domain of BCL10, a postive regulator of apoptosis and NF-kappaB activation, and is thought to function as a molecular scaffold for the assembly of a BCL10 signaling complex that activates NF-kappaB. Several alternatively spliced transcript variants have been observed, but their full-length nature is not clearly defined. |
Synonyms | CANDF2; hCARD9 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 92%; Mouse: 90%; Horse: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | NOD-like receptor signaling pathway |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
CARD9-Dependent Neutrophil Recruitment Protects against Fungal Invasion of the Central Nervous System
,null,
PLoS Pathogens
,PubMed ID 26679537
[CARD9]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |