MRPS33 Rabbit Polyclonal Antibody
CAT#: TA344642
Rabbit Polyclonal Anti-MRPS33 Antibody - middle region
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Mrps33 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DWYPNHNTYFALMGNLRFLGLYRDEHQDFKDEQRRLKKLRGKGKPRKGEG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 12 kDa |
Gene Name | mitochondrial ribosomal protein S33 |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | CGI-139; MRP-S33; PTD003; S33mt |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rabbit: 92%; Bovine: 83% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |