SERPINB8 Rabbit Polyclonal Antibody

CAT#: TA344594

Rabbit Polyclonal Anti-SERPINB8 Antibody - middle region



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (3)
Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 8 (SERPINB8), transcript variant 2
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 8 (SERPINB8), transcript variant 3, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SERPINB8 antibody: synthetic peptide directed towards the middle region of human SERPINB8. Synthetic peptide located within the following region: KAWTNSEKLTKSKVQVFLPRLKLEESYDLEPFLRRLGMIDAFDEAKADFS
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 43 kDa
Gene Name serpin family B member 8
Background The superfamily of high molecular weight serine proteinase inhibitors (serpins) regulate a diverse set of intracellular and extracellular processes such as complement activation, fibrinolysis, coagulation, cellular differentiation, tumor suppression, apoptosis, and cell migration. Serpins are characterized by well-conserved a tertiary structure that consists of 3 beta sheets and 8 or 9 alpha helices (Huber and Carrell, 1989 [PubMed 2690952]). A critical portion of the molecule, the reactive center loop connects beta sheets A and C. Protease inhibitor-8 (PI8; SERPINB8) is a member of the ov-serpin subfamily, which, relative to the archetypal serpin PI1 (MIM 107400), is characterized by a high degree of homology to chicken ovalbumin, lack of N- and C-terminal extensions, absence of a signal peptide, and a serine rather than an asparagine residue at the penultimate position (summary by Bartuski et al., 1997 [PubMed 9268635]).
Synonyms CAP2; PI8
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Pig: 92%; Horse: 92%; Sheep: 91%; Bovine: 91%; Rabbit: 86%; Guinea pig: 83%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...