HS747E2A (C22orf31) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C22orf31 antibody: synthetic peptide directed towards the N terminal of human C22orf31. Synthetic peptide located within the following region: ASSFSLVKLVLRRQLKNKCCPPPCKFGEGKLSKRLKHKDDSVMKATQQAR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	chromosome 22 open reading frame 31
Database Link	NP_056185 Entrez Gene 25770 Human UniProt ID O95567
Background	The function of this protein remains unknown.
Synonyms	bK747E2.1; HS747E2A
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.