ZNF334 Rabbit Polyclonal Antibody
CAT#: TA344476
Rabbit Polyclonal Anti-ZNF334 Antibody - N-terminal region
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF334 antibody: synthetic peptide directed towards the N terminal of human ZNF334. Synthetic peptide located within the following region: KMKKFQIPVSFQDLTVNFTQEEWQQLDPAQRLLYRDVMLENYSNLVSVGY |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 80 kDa |
Gene Name | zinc finger protein 334 |
Database Link | |
Background | ZNF334 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 14 C2H2-type zinc fingers and 1 KRAB domain. ZNF334 may be involved in transcriptional regulation. |
Synonyms | OTTHUMP00000031209; zinc finger protein 334 |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 86%; Dog: 79%; Pig: 79%; Rat: 79%; Horse: 79%; Mouse: 79%; Bovine: 79% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |